Cagrilintide 10mg

Cagrilintide Peptide Structure

Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

Molecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂

Molecular Weight: 4409 g/mol

PubChem CID:  171397054

Synonyms:

• 1415456-99-3
• Cagrilintide [INN]
• AO43BIF1U8
• LDERDVMBIYGIOI-IZVMHKDJSA-N

You may also be interested in:

Bacteriostatic water 10ml

Retatrutide 10mg

Lyophilized Peptides:

Our cagrilintide is provided as a lyophilized (freeze-dried) powder. This process extends shelf life and preserves the purity and integrity of the peptide without the use of any fillers.

Product Usage Disclaimer
This product is supplied strictly as a research chemical. It is intended solely for laboratory experimentation and in vitro studies. Any information provided on this website is for educational and research purposes only.

This material should only be handled by qualified, licensed professionals. It is not a drug, food, or cosmetic, and must not be misused, misbranded, or represented as such.

Research Use Disclaimer
All information provided on this site is intended strictly for research and educational purposes only. The peptides and related materials discussed are not intended for human consumption, medical use, or any non-research application. References to potential effects or benefits are presented for informational and scholarly purposes and should not be interpreted as medical, legal, or professional advice.

These products are supplied solely for use in controlled laboratory settings by qualified professionals. They are not approved for diagnostic, therapeutic, or recreational use. Before acquiring or working with research peptides, we strongly recommend consulting with scientific experts, healthcare professionals, and legal advisors to ensure compliance with all applicable laws and ethical standards.

By accessing this content, you acknowledge and agree to use the information responsibly, with the expectation that it will support legitimate research and academic investigation only. This disclaimer applies to all content provided regarding research peptides and may be updated as necessary.