Cagrilintide 5mg

£65.00

Cagrilintide 5mg long-acting amylin analogue for appetite regulation research

Out of stock

SKU: cagrilintide-5mg Category:

Cagrilintide Peptide Structure

Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

Molecular Formula: C194H312N54O59S2

Molecular Weight: 4409 g/mol

PubChem CID:  171397054

Synonyms:

  • 1415456-99-3
  • Cagrilintide [INN]
  • AO43BIF1U8
  • LDERDVMBIYGIOI-IZVMHKDJSA-N

You may also be interested in:

Bacteriostatic water 10ml

Retatrutide 10mg

Lyophilized Peptides:

Our cagrilintide is provided as a lyophilized (freeze-dried) powder. This process extends shelf life and preserves the purity and integrity of the peptide without the use of any fillers.

Product Usage Disclaimer
This product is supplied strictly as a research chemical. It is intended solely for laboratory experimentation and in vitro studies. Any information provided on this website is for educational and research purposes only.

This material should only be handled by qualified, licensed professionals. It is not a drug, food, or cosmetic, and must not be misused, misbranded, or represented as such.

Research Use Disclaimer
All information provided on this site is intended strictly for research and educational purposes only. The peptides and related materials discussed are not intended for human consumption, medical use, or any non-research application. References to potential effects or benefits are presented for informational and scholarly purposes and should not be interpreted as medical, legal, or professional advice.

These products are supplied solely for use in controlled laboratory settings by qualified professionals. They are not approved for diagnostic, therapeutic, or recreational use. Before acquiring or working with research peptides, we strongly recommend consulting with scientific experts, healthcare professionals, and legal advisors to ensure compliance with all applicable laws and ethical standards.

By accessing this content, you acknowledge and agree to use the information responsibly, with the expectation that it will support legitimate research and academic investigation only. This disclaimer applies to all content provided regarding research peptides and may be updated as necessary.

Reviews

There are no reviews yet.

Be the first to review “Cagrilintide 5mg”

Your email address will not be published. Required fields are marked *

⚠️

Age Verification Required

Blueprint Peptides sells research chemicals strictly for laboratory and research purposes only.

⚠️ Products are NOT for human consumption
⚠️ For research use only
⚠️ Must be 18+ to access this site

Are you 18 years of age or older?

Scroll to Top

✓ Product Added to Basket!

What would you like to do next?

✓ Product Added to Basket!

What would you like to do next?